Subdomain Finder

Consider helping the project, check out our Hall of Fame

Result of childrenscampaignfund.org


Scan date 2024-07-28 08:27:54
Domain Country: Not associated with a country
Subdomains found: 2
Most used IP: 34.149.87.45 (1x)
Whois Check Check Status Download JSON Download CSV Copy to clipboard
Subdomain IP Cloudflare
www.childrenscampaignfund.org 34.149.87.45
investinwakids.childrenscampaignfund.org none
Show 1 subdomains without IP
IP Count
34.149.87.451

More scans of childrenscampaignfund.org

Performing a scan might take up to 1 minute. So please be patient while we're scanning. After a subdomain has been scanned, we will store the data in our cache for 7 days.

Disclaimer: All data that is fetched is coming from public sources making it not fall under disclosing private information as any individual can reach this data with the right steps of research. If you believe your information is published by mistake and want specific data to be removed, make sure to send us an email proving you are the owner of this data and which data you want to have removed. If you are acting on behalf of your client, make sure to provide us with a signed statement proving so.
If you believe we are violating any law by publishing certain data, make sure to contact us with the specific law you believe we are violating. We are not affiliated with childrenscampaignfund.org.

If you have any questions or suggestions, feel free to send an email to [email protected]

Brought to you by C99.nl